Proteintech, 68359-1-Ig, MID2 Monoclonal antibody

Size: 20ul / 150ul The MID2 (68359-1-Ig) by Proteintech is a Monoclonal antibody targeting MID2 in WB, ELISA applications with reactivity to Human samples 68359-1-Ig targets MID2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, MCF-7 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Midline2 (MID2) is an ubiquitin-conjugating E2 enzyme that is involved in tumor development and has a physical interaction with breast cancer 1,early-onset (BRCA1). Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30793 Product name: Recombinant human MID2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 336-685 aa of BC017707 Sequence: AERVAMATASSQVLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTITVHWISDDEFSISSYELQYTIFTGQANFISLYNSVDSWMIVPNIKQNHYTVHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPHLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKTCH Predict reactive species Full Name: midline 2 Calculated Molecular Weight: 715 aa, 81 kDa Observed Molecular Weight: 80~83 kDa GenBank Accession Number: BC017707 Gene Symbol: MID2 Gene ID (NCBI): 11043 RRID: AB_3085081 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UJV3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.