Proteintech, 68360-1-Ig, MCTS1 Monoclonal antibody

Size: 20ul / 150ul The MCTS1 (68360-1-Ig) by Proteintech is a Monoclonal antibody targeting MCTS1 in WB, IF/ICC, ELISA applications with reactivity to human samples 68360-1-Ig targets MCTS1 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells, HeLa cells, Raji cells, Jurkat cells, K-562 cells, MOLT-4 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information MCTS1 is an anti-oncogene that plays a role in cell cycle regulation. It can reduce cell doubling time and anchor-dependent growth. The G1 transition time and the duration of the G1 / S transition are shortened. It can also promote the release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (PMID: 10440924). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7057 Product name: Recombinant human MCTS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-181 aa of BC001013 Sequence: MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIEILTVNGELLFFRQREGPFYPTLRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTSPGAKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTYK Predict reactive species Full Name: malignant T cell amplified sequence 1 Calculated Molecular Weight: 21 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC001013 Gene Symbol: MCTS1 Gene ID (NCBI): 28985 RRID: AB_3085082 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9ULC4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.