Iright
BRAND / VENDOR: Proteintech

Proteintech, 68364-1-Ig, DSP Monoclonal antibody

CATALOG NUMBER: 68364-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DSP (68364-1-Ig) by Proteintech is a Monoclonal antibody targeting DSP in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse samples 68364-1-Ig targets DSP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, A431 cells, MCF-7 cells, HEK-293 cells Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information The desmoplakin (DP) is the most abundant desmosomal proteins and is located at the cytoplasmic portion of the desmosomes which are specialized cell-cell adhesion structures abundant in tissues such as muscle and epidermis that are subjected to mechanical stress. Desmoplakin 1 and 2 (DP 1 and 2) are two splice variants sharing common C-terminal and N-terminal globular head and tail domains, but differ in the length of the rod domain that links them. This antibody detects both DP1 (280-330 kDa) and DP2 (240-260 kDa). (PMID: 16467215, 11781569) Specification Tested Reactivity: Human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30499 Product name: Recombinant human DSP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC140802 Sequence: MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAY Predict reactive species Full Name: desmoplakin Calculated Molecular Weight: 2871 aa, 332 kDa Observed Molecular Weight: 240-330 kDa GenBank Accession Number: BC140802 Gene Symbol: DSP Gene ID (NCBI): 1832 RRID: AB_3085085 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P15924 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924