Iright
BRAND / VENDOR: Proteintech

Proteintech, 68372-1-Ig, ACTRT3/ARPM1 Monoclonal antibody

CATALOG NUMBER: 68372-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ACTRT3/ARPM1 (68372-1-Ig) by Proteintech is a Monoclonal antibody targeting ACTRT3/ARPM1 in WB, IHC, ELISA applications with reactivity to Human, rat, rabbit samples 68372-1-Ig targets ACTRT3/ARPM1 in WB, IHC, ELISA applications and shows reactivity with Human, rat, rabbit samples. Tested Applications Positive WB detected in: NCCIT cells, Rabbit testis, Rat testis, Human testis Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: Human, rat, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33162 Product name: Recombinant human ARPM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 16-233 aa of BC007289 Sequence: MIKAGVAGCREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPVERGLITSCEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFEHLGVPAFYMSIQAVLALFAAGFTTGLVLNSGAGVTQSVPIFEGYCLPHGVQQLDLAGLDLTNYLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMAKKPDCL Predict reactive species Full Name: actin related protein M1 Calculated Molecular Weight: 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC007289 Gene Symbol: ACTRT3/ARPM1 Gene ID (NCBI): 84517 RRID: AB_3085092 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BYD9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924