Iright
BRAND / VENDOR: Proteintech

Proteintech, 68388-1-Ig, ANKRD54 Monoclonal antibody

CATALOG NUMBER: 68388-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANKRD54 (68388-1-Ig) by Proteintech is a Monoclonal antibody targeting ANKRD54 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 68388-1-Ig targets ANKRD54 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Ankyrin repeat domain 54 (ANKRD54)/Liar is a nuclear-cytoplasmic shuttling adaptor that interacts with Lyn, Btk, Txk, and HCLS1. Activation of PKC kinases promoted nuclear export and phosphorylation of Ankrd54, and increased interaction and cytoplasmic co-localization with Lyn. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag22772 Product name: Recombinant human ANKRD54 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 201-300 aa of BC066909 Sequence: RVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR Predict reactive species Full Name: ankyrin repeat domain 54 Calculated Molecular Weight: 300 aa, 33 kDa Observed Molecular Weight: 33-35 kDa GenBank Accession Number: BC066909 Gene Symbol: ANKRD54 Gene ID (NCBI): 129138 RRID: AB_3085106 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6NXT1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924