Proteintech, 68401-1-Ig, AMOTL2 Monoclonal antibody

Size: 20ul / 150ul The AMOTL2 (68401-1-Ig) by Proteintech is a Monoclonal antibody targeting AMOTL2 in WB, IF/ICC, ELISA applications with reactivity to Human samples 68401-1-Ig targets AMOTL2 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, DU 145 cells, Saos-2 cells, NCI-H1299 cells, MDA-MB-468 cells, SK-BR-3 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Angiomotin‑like 2 (AMOTL2) is a member of the motin family of angiostatin‑binding proteins. The motin family, also known as AMOTs, consists of three members: AMOT, AMOT-like 1 (AMOTL1) and AMOTL2. Members of the motin family are a type of adaptor proteins mainly distributed in the cytomembrane, cytoplasm or nucleus, and have a higher expression in the endothelial cells of capillaries and in larger vessels of the placenta. Human AmotL2 encodes two isoforms of a molecular mass of 100 kDa and 60 kDa.(PMID: 34036399,PMID: 25080976) Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19971 Product name: Recombinant human AMOTL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 340-466 aa of BC011454 Sequence: DPGKAIQGSLRPAKSVPSVFAAAAAGTQGWQGLSSSERQTADAPARLTTDRAPTEEPVVTAPPAAHAKHGSRDGSTQTEGPPDSTSTCLPPEPDSLLGCSSSQRAASLDSVATSRVQDLSDMVEILI Predict reactive species Full Name: angiomotin like 2 Calculated Molecular Weight: 779 aa, 86 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC011454 Gene Symbol: AMOTL2 Gene ID (NCBI): 51421 RRID: AB_3085118 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y2J4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.