Iright
BRAND / VENDOR: Proteintech

Proteintech, 68404-1-Ig, NPHP5/IQCB1 Monoclonal antibody

CATALOG NUMBER: 68404-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NPHP5/IQCB1 (68404-1-Ig) by Proteintech is a Monoclonal antibody targeting NPHP5/IQCB1 in WB, ELISA applications with reactivity to Human samples 68404-1-Ig targets NPHP5/IQCB1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HaCaT cells, A431 cells, HT-1376 cells, Saos-2 cells, MDA-MB-468 cells, HEK-293 cells, COLO 320 cells, HL-60 cells, Daudi cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information IQCB1, also known as NPHP5, is a nephrocystin protein that interacts with calmodulin and the retinitis pigmentosa GTPase regulator protein. It has a central coiled-coil region and two calmodulin-binding IQ domains. Localized to the primary cilia of renal epithelial cells and connecting cilia of photoreceptor cells, IQCB1 is thought to play a role in ciliary function. Mutations in this gene result in Senior-Loken syndrome type 5, a juvenile disorder characterized by defects in the waste filtering system of the kidney, as well as retinal degradation. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8203 Product name: Recombinant human NPHP5,IQCB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC005806 Sequence: MKPTGTDPRILSIAAEVAKSPEQNVPVILLKLKEIINITPLGSSELKKIKQDIYCYDLIQYCLLVLSQDYSRIQGGWTTISQLTQILSHCCVGLEPGEDAEEFYNELLPSAAENFLVLGRQLQTCFINAAKAEEKDELLHFFQIVTDSLFWLLGGHVELIQNVLQSDHFLHLLQADNVQIGSAVMMMLQNILQINRSKRSKMLLEINRQKEEEDLKLQLQLQRQRAMRLSRELQLSMLEIVHPGQVEKHYREMEEKSALIIQKHWRGYRERKNFHQQRQSLIEYKAAVTLQRAALKFLAKYRKKKKLFAPWRGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSRELH Predict reactive species Full Name: IQ motif containing B1 Calculated Molecular Weight: 598 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC005806 Gene Symbol: IQCB1 Gene ID (NCBI): 9657 RRID: AB_3085121 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15051 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924