Proteintech, 68412-1-Ig, TAP1 Monoclonal antibody

Size: 20ul / 150ul The TAP1 (68412-1-Ig) by Proteintech is a Monoclonal antibody targeting TAP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human samples 68412-1-Ig targets TAP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A2780 cells, SW 1990 cells, HeLa cels, MDA-MB-231 cells, HaCaT cells, THP-1 cells, Daudi cells, Ramos cells, Raji cells Positive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information TAP1, also known as ABCB2, PSF1 or RING4, is a member of the ATP-binding cassette (ABC) family of transmembrane transporters and is an essential component of the major histocompatability complex (MHC) class I antigen-presenting pathway. TAP is involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. It also acts as a molecular scaffold for the final stage of MHC class I folding. Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1). Western blot analysis using this antibody detected a major band around 70 kDa. Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21303 Product name: Recombinant human TAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 509-808 aa of BC014081 Sequence: LYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLEGLVQFQDVSFAYPNRPDVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLITQHLSLVEQADHILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE Predict reactive species Full Name: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP) Calculated Molecular Weight: 81 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC014081 Gene Symbol: TAP1 Gene ID (NCBI): 6890 RRID: AB_3085128 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q03518 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.