Proteintech, 68414-1-Ig, HSDL2 Monoclonal antibody

Size: 20ul / 150ul The HSDL2 (68414-1-Ig) by Proteintech is a Monoclonal antibody targeting HSDL2 in WB, IF/ICC, ELISA applications with reactivity to Human, pig, rabbit samples 68414-1-Ig targets HSDL2 in WB, IF/ICC, ELISA applications and shows reactivity with Human, pig, rabbit samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, LNCaP cells, HEK-293 cells, Jurkat cells, pig heart tissue, rabbit heart tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Human hydroxysteroid dehydrogenase-like 2 (HSDL2) is a characterized SDR gene that not only catalyses the oxidation and reduction of multiple substrates but also regulates different metabolic and signalling pathways. Accumulating evidences suggest that HSDL2 play an important role in cancer progression. HSDL2 has promoting effects on tumor progression in papillary thyroid cancer, bladder cancer, ovarian cancer, and glioma, but has suppressing effects in cholangiocarcinoma . ( PMID: 31372054, PMID: 32211805) Specification Tested Reactivity: Human, pig, rabbit Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8314 Product name: Recombinant human HSDL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-345 aa of BC004331 Sequence: MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALPCIVDVRDEQQISAAVEKAIKKFGAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEAVSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL Predict reactive species Full Name: hydroxysteroid dehydrogenase like 2 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC004331 Gene Symbol: HSDL2 Gene ID (NCBI): 84263 RRID: AB_3085130 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6YN16 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.