Iright
BRAND / VENDOR: Proteintech

Proteintech, 68421-1-Ig, ARL3 Monoclonal antibody

CATALOG NUMBER: 68421-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARL3 (68421-1-Ig) by Proteintech is a Monoclonal antibody targeting ARL3 in WB, IF/ICC, ELISA applications with reactivity to Human, rat, rabbit samples 68421-1-Ig targets ARL3 in WB, IF/ICC, ELISA applications and shows reactivity with Human, rat, rabbit samples. Tested Applications Positive WB detected in: HeLa cells, rabbit testis tissue, rat retina tissue Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information ARL3 (ADP-ribosylation factor-like 3) is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. ARL3 is believed to be involved in ciliary and microtubule-dependent processes. Specification Tested Reactivity: Human, rat, rabbit Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21387 Product name: Recombinant human ARL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-182 aa of BC009841 Sequence: MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK Predict reactive species Full Name: ADP-ribosylation factor-like 3 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20-24 kDa GenBank Accession Number: BC009841 Gene Symbol: ARL3 Gene ID (NCBI): 403 RRID: AB_3085136 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P36405 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924