Iright
BRAND / VENDOR: Proteintech

Proteintech, 68428-1-Ig, ARID3A Monoclonal antibody

CATALOG NUMBER: 68428-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARID3A (68428-1-Ig) by Proteintech is a Monoclonal antibody targeting ARID3A in WB, IF/ICC, ELISA applications with reactivity to human samples 68428-1-Ig targets ARID3A in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HuH-7 cells, Jurkat cells, K-562 cells, TF-1 cells, HepG2 cells Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information ARID3A is a nuclear matrix-associated transcription factor that stimulates immunoglobulin heavy chain (IgH) expression and Cyclin E1/E2F-dependent cell cycle progression. It activates IgH transcriptional initiation by binding to ATC-rich P sites within nuclear matrix attachment regions (MARs) flanking the IgH intronic enhancer (Emu) (PMID:17386101). It is the founder of the 13-member (in humans) ARID (AT-Rich Interaction Domain) family, which share a highly conserved DNA binding domain, but functions in diverse biological processes such as cell cycle regulated events, epigenetic post-translational modification, and chromatin remodeling (PMID:15927959,11959810,11283269). The expression molecular weight observed is consistent with what has been described in the literature (PMID: 15922553, 19436740). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7655 Product name: Recombinant human ARID3A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 244-593 aa of BC060828 Sequence: FLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMEYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGHPVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQNFLAMAAQLPMSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPAPTPTSAPNKGGGGGGSSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP Predict reactive species Full Name: AT rich interactive domain 3A (BRIGHT-like) Calculated Molecular Weight: 63 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC060828 Gene Symbol: ARID3A Gene ID (NCBI): 1820 RRID: AB_3085142 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99856 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924