Iright
BRAND / VENDOR: Proteintech

Proteintech, 68432-1-Ig, CD8b Monoclonal antibody

CATALOG NUMBER: 68432-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD8b (68432-1-Ig) by Proteintech is a Monoclonal antibody targeting CD8b in IHC, ELISA applications with reactivity to human samples 68432-1-Ig targets CD8b in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information CD8b (T-cell surface glycoprotein CD8 beta chain) is an integral membrane glycoprotein that forms disulfide-linked heterodimers with CD8a (CD8 alpha chain). The CD8 alpha/beta heterodimer is the predominant CD8 complex expressed on the cell surface (PMID: 1534146; 2111591). CD8 is a transmembrane glycoprotein predominantly expressed on cytotoxic T cells and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16925 Product name: Recombinant human CD8B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 22-171 aa of BC100913 Sequence: LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSPI Predict reactive species Full Name: CD8b molecule Calculated Molecular Weight: 243 aa, 27 kDa GenBank Accession Number: BC100913 Gene Symbol: CD8B Gene ID (NCBI): 926 RRID: AB_3085146 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P10966 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924