Proteintech, 68439-1-Ig, ARP3/ARP3B Monoclonal antibody

Size: 20ul / 150ul The ARP3/ARP3B (68439-1-Ig) by Proteintech is a Monoclonal antibody targeting ARP3/ARP3B in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat, rabbit, pig samples 68439-1-Ig targets ARP3/ARP3B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples. Tested Applications Positive WB detected in: Calu-3 cells, A549 cells, U2OS cells, HeLa cells, Human peripheral blood platelets, Pig lung tissue, Rabbit lung tissue, Rat lung tissue, Mouse lung tissue Positive IHC detected in: mouse brain tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HUVEC cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information ARP3 (also known as ACTR3) is a major constituent of the ARP2/3 complex that is necessary for nucleating actin polymerization at filament branches. ARP3 localizes to the lamellipodia of stationary and locomoting fibroblasts. Overexpression of ARP3 has been reported in several types of cancer cells. This antibody recognizes endogenous ARP3 and may cross-react with ATCR3B. Specification Tested Reactivity: Human, mouse, rat, rabbit, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5017 Product name: Recombinant human ACTR3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 156-418 aa of BC044590 Sequence: RQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS Predict reactive species Full Name: ARP3 actin-related protein 3 homolog (yeast) Calculated Molecular Weight: 418 aa 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC044590 Gene Symbol: ARP3/ACTR3 Gene ID (NCBI): 10096 RRID: AB_3085152 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P61158 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.