Proteintech, 68451-1-Ig, GIMAP7 Monoclonal antibody

Size: 20ul / 150ul The GIMAP7 (68451-1-Ig) by Proteintech is a Monoclonal antibody targeting GIMAP7 in WB, IF/ICC, IP, ELISA applications with reactivity to Human samples 68451-1-Ig targets GIMAP7 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: NK-92 cells, Jurkat cells, MOLT-4 cells, HUVEC cells Positive IP detected in: Jurkat cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information GIMAP7, also known as hIAN7 or IAN 7, is a transmembrane protein located in the endoplasmic reticulum and Golgi apparatus. GIMAP7 can promote oxidative stress and apoptosis in ovarian granulosa cells in Polycystic ovary syndrome by inhibiting the SHH signalling pathway(PMID: 36581994). The MW of this protein is 34 kDa, and this antibody specially recognises the 34 kDa protein. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10740 Product name: Recombinant human GIMAP7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-300 aa of BC027613 Sequence: MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDTKESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQSFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEVLRKIYTDQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRIWKMLSEIWHRFLSKCKFYSS Predict reactive species Full Name: GTPase, IMAP family member 7 Calculated Molecular Weight: 300 aa, 35 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC027613 Gene Symbol: GIMAP7 Gene ID (NCBI): 168537 RRID: AB_3085163 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8NHV1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.