Iright
BRAND / VENDOR: Proteintech

Proteintech, 68458-1-Ig, CRTAP Monoclonal antibody

CATALOG NUMBER: 68458-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRTAP (68458-1-Ig) by Proteintech is a Monoclonal antibody targeting CRTAP in WB, ELISA applications with reactivity to Human samples 68458-1-Ig targets CRTAP in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HT-1080 cells, HT1080, HT-1376, Saos-2, MDA-MB-231, HeLa, U251 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8456 Product name: Recombinant human CRTAP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 50-401 aa of BC008745 Sequence: HALDKYSGEHWAESVGYLEISLRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLKRCKQGLPAFRQSQPSRDVLADFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYESLFIRAVRAYNGENWRTSITDMELALPDFFKAFYECLAACEGSREIKDFKDFYLSIADHYVEVLECKIQCEENLTPVIGGYPVEKFVATMYHYLQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS Predict reactive species Full Name: cartilage associated protein Calculated Molecular Weight: 46.5 kDa Observed Molecular Weight: 43-47 kDa GenBank Accession Number: BC008745 Gene Symbol: CRTAP Gene ID (NCBI): 10491 RRID: AB_3085170 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75718 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924