Proteintech, 68459-1-Ig, SQRDL Monoclonal antibody

Size: 20ul / 150ul The SQRDL (68459-1-Ig) by Proteintech is a Monoclonal antibody targeting SQRDL in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, pig samples 68459-1-Ig targets SQRDL in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, HT-29 cells, hTERT-RPE1 cells, THP-1 cells, pig liver tissue Positive IP detected in: HeLa cells Positive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SQRDL(Sulfide:quinone oxidoreductase, mitochondrial) catalyzes the oxidation of hydrogen sulfide, with the help of a quinone.Although the SQRDL precursor protein displays a molecular weight of 50 kDa,a prominent band at about 46 kDa is detected by western blot. This discrepancy reflects the cleavage of an N-terminal targeting sequence of 4 kDa during the import of the protein into the mitochondria(PMID:22067608).SQRDL is one of the enzymes involved in H2S signaling in a discrete population of neurons, oligodendrocytes, and endothelial cells. Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10762 Product name: Recombinant human SQRDL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-450 aa of BC016836 Sequence: GRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWGGPAFLRKLFHLGMS Predict reactive species Full Name: sulfide quinone reductase-like (yeast) Calculated Molecular Weight: 450 aa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC016836 Gene Symbol: SQRDL Gene ID (NCBI): 58472 RRID: AB_3085171 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y6N5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.