Iright
BRAND / VENDOR: Proteintech

Proteintech, 68462-1-Ig, UGCGL1 Monoclonal antibody

CATALOG NUMBER: 68462-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UGCGL1 (68462-1-Ig) by Proteintech is a Monoclonal antibody targeting UGCGL1 in WB, ELISA applications with reactivity to Human samples 68462-1-Ig targets UGCGL1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, Jurkat cells, human placenta tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information UDP-glucose:glycoprotein glucosyltransferase 1 (UGCGL1) is a central quality control gatekeeper in the mammalian endoplasmic reticulum (ER) and serves as a folding sensor in the calnexin/calreticulin glycoprotein quality control cycle (PMID: 28425917). UGCGL1 acts as a checkpoint in the quality control of the MHC class I antigen presentation pathway (PMID: 21383159). Western blot analysis detected UGCGL1at an apparent molecular mass of 170 kDa. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5940 Product name: Recombinant human UGCGL1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1221-1531 aa of BC041098 Sequence: TEEVKQDKDDIINIFSVASGHLYERFLRIMMLSVLKNTKTPVKFWFLKNYLSPTFKEFIPYMANEYNFQYELVQYKWPRWLHQQTEKQRIIWGYKILFLDVLFPLVVDKFLFVDADQIVRTDLKELRDFNLDGAPYGYTPFCDSRREMDGYRFWKSGYWASHLAGRKYHISALYVVDLKKFRKIAAGDRLRGQYQGLSQDPNSLSNLDQDLPNNMIHQVPIKSLPQEWLWCETWCDDASKKRAKTIDLCNNPMTKEPKLEAAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREEL Predict reactive species Full Name: UDP-glucose ceramide glucosyltransferase-like 1 Calculated Molecular Weight: 1531 aa, 175 kDa Observed Molecular Weight: 170 kDa GenBank Accession Number: BC041098 Gene Symbol: UGCGL1 Gene ID (NCBI): 56886 RRID: AB_3670381 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NYU2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924