Proteintech, 68464-1-Ig, TEAD3 Monoclonal antibody

Size: 20ul / 150ul The TEAD3 (68464-1-Ig) by Proteintech is a Monoclonal antibody targeting TEAD3 in WB, IF-P, ELISA applications with reactivity to human, pig samples 68464-1-Ig targets TEAD3 in WB, IF-P, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HCT 116 cells, JAR cells, HepG2 cells, U2OS cells, pig heart tissue Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information TEAD3, others named transcription enhancer factor 5(TEF5), is a member of the family of transcription factors that plays a key role in the Hippo signaling pathway, suggesting involvement in organ and tumor suppression by restricting proliferation and promoting. TEAD3 contains the TEA/ATTS DNA-binding domain. Human TEAD3 has a strong mRNA expression in the placenta and choriocarcinoma cells(JEG-3) but is low in Hela, HepG2, and MCF-7. Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4407 Product name: Recombinant human TEAD3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-324 aa of BC027877 Sequence: MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD Predict reactive species Full Name: TEA domain family member 3 Calculated Molecular Weight: 435 aa, 49 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC027877 Gene Symbol: TEAD3 Gene ID (NCBI): 7005 RRID: AB_3085175 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q99594 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.