Iright
BRAND / VENDOR: Proteintech

Proteintech, 68466-1-Ig, SMURF1 Monoclonal antibody

CATALOG NUMBER: 68466-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMURF1 (68466-1-Ig) by Proteintech is a Monoclonal antibody targeting SMURF1 in WB, ELISA applications with reactivity to human, mouse samples 68466-1-Ig targets SMURF1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, MCF-7 cells, A549 cells, U2OS cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SMURF1, also named as KIAA1625, is E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. SMURF1 interacts with receptor-regulated SMADs specific for the BMP pathway, SMAD1 and SMAD5, in order to trigger their ubiquitination and degradation and hence their inactivation. SMURF1 can be detected as 90-100 kDa when ubiquitinated (PMID:17576816, PMID:20484049). Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30891 Product name: Recombinant human SMURF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 150-269 aa of NM_020429 Sequence: VDCRGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPS Predict reactive species Full Name: SMAD specific E3 ubiquitin protein ligase 1 Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 86 kDa GenBank Accession Number: NM_020429 Gene Symbol: SMURF1 Gene ID (NCBI): 57154 RRID: AB_3085177 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9HCE7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924