Iright
BRAND / VENDOR: Proteintech

Proteintech, 68474-1-Ig, AMY2B Monoclonal antibody

CATALOG NUMBER: 68474-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AMY2B (68474-1-Ig) by Proteintech is a Monoclonal antibody targeting AMY2B in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 68474-1-Ig targets AMY2B in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig pancreas tissue, rat pancreas tissue,mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information AMY2B(alpha-amylase 2B) belongs to the glycosyl hydrolase 13 family. This protein is involved in the endohydrolysis of 1,4-alpha-glucosidic linkages in oligosaccharides and polysaccharides. Human amylases (Amy1, Amy2A, and Amy2B) commonly have two potential N-glycosylation sites (N427 and N476) in their C-terminal region (S Takashima, J Amano, 2012). Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3260 Product name: Recombinant human AMY2B protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 160-511 aa of BC011179 Sequence: SGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL Predict reactive species Full Name: amylase, alpha 2B (pancreatic) Calculated Molecular Weight: 511 aa, 58 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC011179 Gene Symbol: AMY2B Gene ID (NCBI): 280 RRID: AB_3085185 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P19961 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924