Iright
BRAND / VENDOR: Proteintech

Proteintech, 68478-1-Ig, NUDT10 Monoclonal antibody

CATALOG NUMBER: 68478-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NUDT10 (68478-1-Ig) by Proteintech is a Monoclonal antibody targeting NUDT10 in WB, ELISA applications with reactivity to Human, mouse, rat samples 68478-1-Ig targets NUDT10 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: U2OS cells, rat brain tissue, HEK-293 cells, rat testis tissue, mouse testis tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information NUDT10 (nucleoside diphosphate linked moiety X-type motif 10), also named as DIPP3A or APS2, belongs to the subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (PMID: 12105228, 12689335). Five human isoforms of DIPP have been found and named as DIPP type 1(NUDT3), type 2α/β(NUDT4), type 3α(NUDT10) and type 3β(NUDT11), which have the similar molecular weight and high homology (PMID: 12105228). Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11878 Product name: Recombinant human NUDT10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-164 aa of BC050700 Sequence: MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPEHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 10 Calculated Molecular Weight: 164 aa, 19 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC050700 Gene Symbol: NUDT10 Gene ID (NCBI): 170685 RRID: AB_3085189 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NFP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924