Proteintech, 68495-1-Ig, TJAP1 Monoclonal antibody

Size: 20ul / 150ul The TJAP1 (68495-1-Ig) by Proteintech is a Monoclonal antibody targeting TJAP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 68495-1-Ig targets TJAP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, HeLa cells, HEK-293 cells, MDA-MB-231 cells, HSC-T6 cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TJAP1, also named as PILT and TJP4, is colocalized at the tight junctions. TJAP1 has some forms with MW 60 kDa (native) and 86-90 kDa (modified). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11807 Product name: Recombinant human TJAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC064401 Sequence: MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENEELRRRLASATRRTEALERELEIGQDCLELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQSGSAGRPLAEDVFVHVDMSEGVPGDPASPPAPGSPTPQPNGECHSLGTARGSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLS Predict reactive species Full Name: tight junction associated protein 1 (peripheral) Calculated Molecular Weight: 547 aa, 61 kDa Observed Molecular Weight: 86-95 kDa GenBank Accession Number: BC064401 Gene Symbol: TJAP1 Gene ID (NCBI): 93643 RRID: AB_3085206 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q5JTD0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.