Proteintech, 68506-1-Ig, ATP6V0D1 Monoclonal antibody

Size: 20ul / 150ul The ATP6V0D1 (68506-1-Ig) by Proteintech is a Monoclonal antibody targeting ATP6V0D1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to Human, Mouse, Rat, Pig, Rabbit, Chicken, Zebrafish samples 68506-1-Ig targets ATP6V0D1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig, Rabbit, Chicken, Zebrafish samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, K-562 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, chicken brain tissue, zebrafish tissue Positive IP detected in: HeLa cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1200-1:4800 Background Information ATP6V0D1(V-type proton ATPase subunit d 1) is also named as ATP6D, VPATPD and belongs to the V-ATPase V0D/AC39 subunit family.It is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. Specification Tested Reactivity: Human, Mouse, Rat, Pig, Rabbit, Chicken, Zebrafish Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13012 Product name: Recombinant human ATP6V0D1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC008861 Sequence: MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF Predict reactive species Full Name: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 Calculated Molecular Weight: 351 aa, 40 kDa Observed Molecular Weight: 37-41 kDa GenBank Accession Number: BC008861 Gene Symbol: ATP6V0D1 Gene ID (NCBI): 9114 RRID: AB_3085216 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P61421 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.