Iright
BRAND / VENDOR: Proteintech

Proteintech, 68513-1-Ig, GATM Monoclonal antibody

CATALOG NUMBER: 68513-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GATM (68513-1-Ig) by Proteintech is a Monoclonal antibody targeting GATM in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 68513-1-Ig targets GATM in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig kidney tissue, rat kidney tissue, mouse kidney tissue, pig pancreas tissue, rat pancreas tissue, mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GATM, also known as AGAT, produces ornithine and guanidinoacetate (GAA) from arginine and glycine, and is a key enzyme for creatine synthesis. GATM deficiency in early infancy causes neurodevelopmental delay. GATM is predominantly expressed in kidney and pancreas in adults. Decrease of GAMT proteins was observed in proximal tubule damage cases, which links GATM as a general marker for proximal tubule damage. Alternative splicing of GATM generates three isoforms with molecular weights between 44 kDa to 48 kDa. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3754 Product name: Recombinant human GATM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 74-423 aa of BC004141 Sequence: PLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQSYLD Predict reactive species Full Name: glycine amidinotransferase (L-arginine:glycine amidinotransferase) Calculated Molecular Weight: 423 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC004141 Gene Symbol: GATM Gene ID (NCBI): 2628 RRID: AB_3085222 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P50440 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924