Proteintech, 68521-1-Ig, RNF8 Monoclonal antibody

Size: 20ul / 150ul The RNF8 (68521-1-Ig) by Proteintech is a Monoclonal antibody targeting RNF8 in WB, ELISA applications with reactivity to Human, mouse, rat, rabbit, pig samples 68521-1-Ig targets RNF8 in WB, ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, K-562 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information RNF8, also named as KIAA0646 or E3 ubiquitin-protein ligase RNF8, is a 485 amino acid protein, which contains one RING-type zinc finger and one FHA domain. RNF8 localizes in the nucleus and belongs to the RNF8 family. E2-E3 ubiquitin ligase complex is composed of the RNF8 homodimer and a E2 heterodimer of UBE2N and UBE2V2. E3 ubiquitin-protein ligase that plays a key role in DNA damage signaling via 2 distinct roles: by mediating the 'Lys-63'-linked ubiquitination of histones H2A and H2AX and promoting the recruitment of DNA repair proteins at double-strand breaks (DSBs) sites, and by catalyzing 'Lys-48'-linked ubiquitination to remove target proteins from DNA damage sites. Specification Tested Reactivity: Human, mouse, rat, rabbit, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5292 Product name: Recombinant human RNF8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 130-485 aa of BC007517 Sequence: ETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF Predict reactive species Full Name: ring finger protein 8 Calculated Molecular Weight: 485 aa, 56 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC007517 Gene Symbol: RNF8 Gene ID (NCBI): 9025 RRID: AB_3085230 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O76064 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.