Proteintech, 68540-1-Ig, SLC1A5/ASCT2 Monoclonal antibody

Size: 20ul / 150ul The SLC1A5/ASCT2 (68540-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC1A5/ASCT2 in WB, IHC, IF/ICC, IF-Fro, FC (Intra), ELISA applications with reactivity to human samples 68540-1-Ig targets SLC1A5/ASCT2 in WB, IHC, IF/ICC, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, PNGase F-treated A431 cells, A549 cells, PNGase F-treated A549 cells, HT-29 cells, PNGase F-treated HT-29 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-Fro detected in: mouse small intestine tissue Positive IF/ICC detected in: HEK-293 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-FRO: IF-FRO : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SLC1A5 (Solute Carrier Family 1, member 5), also named as ASCT2, a major glutamine transporter belonging to the SLC1 family and localized in the plasma membrane of several body districts. Consistent with the functions exerted by glutamine, SLC1A5 is involved in uptake of essential amino acids, activation of mTORC1 and glutamine-dependent tumor cell survival and growth. SLC1A5 is highly expressed in various malignancies and plays a critical role in the transformation, growth and survival of cancer cells (PMID: 30234109). High SLC1A5 expression is associated with poor prognosis in clear-cell renal cell carcinoma (PMID: 26599282). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16837 Product name: Recombinant human RDRC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 436-541 aa of BC000062 Sequence: VLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPLPTEEGNPLLKHYRGPAGDATVASEKESVM Predict reactive species Full Name: solute carrier family 1 (neutral amino acid transporter), member 5 Calculated Molecular Weight: 541 aa, 57 kDa Observed Molecular Weight: 55-70 kDa GenBank Accession Number: BC000062 Gene Symbol: SLC1A5/ASCT2 Gene ID (NCBI): 6510 RRID: AB_3085248 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q15758 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.