Proteintech, 68547-1-Ig, SKIV2L Monoclonal antibody

Size: 20ul / 150ul The SKIV2L (68547-1-Ig) by Proteintech is a Monoclonal antibody targeting SKIV2L in WB, IHC, ELISA applications with reactivity to human samples 68547-1-Ig targets SKIV2L in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, Jurkat cells, MOLT-4 cells, NK-92 cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information The Ski complex is a multiprotein complex required for exosome-mediated RNA surveillance, including the regulation of normal mRNA and the decay of nonfunctional mRNA. Component of the SKI complex which is thought to be involved in exosome-mediated RNA decay and associates with transcriptionally active genes in a manner dependent on PAF1 complex (PAF1C) [PMID:22444670]. SKIV2L , one component of the Ski complex, acts as an RNA helicase with a role in exosome recruitment or activation. It is involved in the degradation of RNAs by the exosome and may have a role in autophagy [PMID:11719186]. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33679 Product name: Recombinant human SKIV2L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 861-1246 aa of BC015758 Sequence: QVSSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGPCDHTVVKLQPGDMAAITTKVLRVNGEKILEDFSKRQQPKFKKDPPLAAVTTAVQELLRLAQAHPAGPPTLDPVNDLQLKDMSVVEGGLRARKLEELIQGAQCVHSPRFPAQYLKLRERMQIQKEMERLRFLLSDQSLLLLPEYHQRVEVLRTLGYVDEVGTVKLAGRVACAMSSHELLLTELMFDNALSTLRPEEIAALLSGLVCQSPGDAGDQLPNTLKQGIERVRAVAKRIGEVQVACGLNQTVEEFVGELNFGLVEVVYEWARGMPFSELAGLSGTPEGLVVRCIQRLAEMCRSLRGAARLVGEPVLGAKMETAATLLRRDIVFAASLYTQ Predict reactive species Full Name: superkiller viralicidic activity 2-like (S. cerevisiae) Calculated Molecular Weight: 1246 aa, 138 kDa Observed Molecular Weight: 138-145 kDa GenBank Accession Number: BC015758 Gene Symbol: SKIV2L Gene ID (NCBI): 6499 RRID: AB_3085252 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15477 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.