Proteintech, 68551-1-Ig, FMNL2 Monoclonal antibody

Size: 20ul / 150ul The FMNL2 (68551-1-Ig) by Proteintech is a Monoclonal antibody targeting FMNL2 in WB, ELISA applications with reactivity to Human samples 68551-1-Ig targets FMNL2 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, hTERT-RPE1 cells, HEK-293 cells, A549 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Formin-like 2 (FMNL2), also known as FRL3 or FHOD2, a member of the diaphanous-related formins, contains a GTPase-binding domain and autoregulatory domains, and is proposed to function as a downstream effector of Rho family guanosine triphosphatases (GTPases) (PMID:15950879). FMNL2 mRNA is expressed in many normal tissues and dysregulated in several cancers such as colorectal cancer, melanoma and involved in invasive behaviours and progression of cancer cells. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag34164 Product name: Recombinant human FMNL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 400-520 aa of BC167159 Sequence: ENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGPTMGA Predict reactive species Full Name: formin-like 2 Observed Molecular Weight: 140-150 kDa GenBank Accession Number: BC167159 Gene Symbol: FMNL2 Gene ID (NCBI): 114793 RRID: AB_3085255 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96PY5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.