Iright
BRAND / VENDOR: Proteintech

Proteintech, 68555-1-Ig, PEX19 Monoclonal antibody

CATALOG NUMBER: 68555-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PEX19 (68555-1-Ig) by Proteintech is a Monoclonal antibody targeting PEX19 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 68555-1-Ig targets PEX19 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: LNCaP cells, HEK-293 cells, HeLa cells, A549 cells, Jurkat cells, K-562 cells, Pig liver tissue, Rat liver tissue, Mouse liver tissue Positive IF/ICC detected in: Jurkat cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. PEX19 gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs) (PMID: 14709540). PEX19 may bind newly synthesized PMPs and facilitate their insertion into the peroxisome membrane (PMID: 107044440. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function. Defects in this gene are a cause of Zellweger syndrome (ZWS), as well as peroxisome biogenesis disorder complementation group 14 (PBD-CG14) (PMID:20683989) (PMID:10051604). Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6858 Product name: Recombinant human PEX19 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-299 aa of BC000496 Sequence: MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM Predict reactive species Full Name: peroxisomal biogenesis factor 19 Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC000496 Gene Symbol: PEX19 Gene ID (NCBI): 5824 RRID: AB_3085258 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P40855 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924