Iright
BRAND / VENDOR: Proteintech

Proteintech, 68557-5-Ig, TFAM Monoclonal antibody

CATALOG NUMBER: 68557-5-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TFAM (68557-5-Ig) by Proteintech is a Monoclonal antibody targeting TFAM in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 68557-5-Ig targets TFAM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Caco-2 cells, HEK-293 cells, U2OS cells, LNCaP cells, MOLT-4 cells, MJ cells, K-562 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TFAM, also named as TCF6L2, MtTF1, TCF6, TCF6L1, TCF6L3, and mtTFA, is a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. It is involved in mitochondrial transcription regulation. TFAM is required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. It activates transcription by binding immediately upstream of transcriptional start sites. TFAM is able to unwind and bend DNA. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18253 Product name: Recombinant human TFAM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-246 aa of BC126366 Sequence: MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC Predict reactive species Full Name: transcription factor A, mitochondrial Calculated Molecular Weight: 246 aa, 29 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC126366 Gene Symbol: TFAM Gene ID (NCBI): 7019 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q00059 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924