Proteintech, 68562-1-Ig, TRPS1 Monoclonal antibody

Size: 20ul / 150ul The TRPS1 (68562-1-Ig) by Proteintech is a Monoclonal antibody targeting TRPS1 in WB, ELISA applications with reactivity to Human samples 68562-1-Ig targets TRPS1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Saos-2 cells, HeLa cells, T-47D cells, MCF-7cells, LNCaP cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information TRPS1 is a zinc finger transcriptional repressor involved in the regulation of chondrocyte and perichondrium development, containing a GATA-type zinc finger through which it binds to DNA. with nine zinc-finger domains and two C-terminal Ikaros-like zinc fingers. Its reperssible function was dependent on the integrity of the Trps1 GATA-type zinc-finger domain and also required the C-terminal 119 amino acids of the protein, which harbor the two Ikaros-like zinc-finger domains Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30199 Product name: Recombinant human TRPS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1158-1281 aa of NM_014112 Sequence: SDNDIPLDLAIKHSRPGPTANGASKEKTKAPPNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE Predict reactive species Full Name: trichorhinophalangeal syndrome I Calculated Molecular Weight: 142 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: NM_014112 Gene Symbol: TRPS1 Gene ID (NCBI): 7227 RRID: AB_3085264 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UHF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.