Proteintech, 68568-1-Ig, LEO1 Monoclonal antibody

Size: 20ul / 150ul The LEO1 (68568-1-Ig) by Proteintech is a Monoclonal antibody targeting LEO1 in WB, ELISA applications with reactivity to Human samples 68568-1-Ig targets LEO1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HepG2 cells, HT-29 cells, A549 cells, HEK-293 cells, LNCaP cells, MCF-7 cells, Hela cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information LEO1, also named as RNA polymerase-associated protein LEO1, is a 666 amino acid protein, which belongs to the LEO1 family. LEO1 is a component of the PAF1 complex (PAF1C) which has multiple functions during transcription by RNA polymerase II and is implicated in regulation of development and maintenance of embryonic stem cell pluripotency. The calculated molecular weight of LEO1 is 75 kDa, but the modified LEO1 protein is about 105 kDa (PMID: 15632063). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33577 Product name: Recombinant human LEO1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-332 aa of BC018147 Sequence: MADMEDLFGSDADSEAERKDSDSGSDSDSDQENAASGSNASGSESDQDERGDSGQPSNKELFGDDSEDEGASHHSGSDNHSERSDNRSEASERSDHEDNDPSDVDQHSGSEAPNDDEDEGHRSDGGSHHSEAEGSEKAHSDDEKWGREDKSDQSDDEKIQNSDDEERAQGSDEDKLQNSDDDEKMQNTDDEERPQLSDDERQQLSEEEKANSDDERPVASDNDDEKQNSDDEEQPQLSDEEKMQNSDDERPQASDEEHRHSDDEEEQDHKSESARGSDSEDEVLRMKRKNAIASDSEADSDTEVPKDNSGTMDLFGGADDISSGSDGEDKPP Predict reactive species Full Name: Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) Calculated Molecular Weight: 666 aa, 75 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC018147 Gene Symbol: LEO1 Gene ID (NCBI): 123169 RRID: AB_3085270 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8WVC0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.