Iright
BRAND / VENDOR: Proteintech

Proteintech, 68574-1-Ig, MAP2K3 Monoclonal antibody

CATALOG NUMBER: 68574-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAP2K3 (68574-1-Ig) by Proteintech is a Monoclonal antibody targeting MAP2K3 in WB, ELISA applications with reactivity to human, mouse, rat samples 68574-1-Ig targets MAP2K3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, A431 cells, HepG2 cells, MCF-7 cells, HeLa cells, A549 cells, Jurkat cells, NIH/3T3 cells, C2C12 cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4861 Product name: Recombinant human MAP2K3 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-347 aa of BC032478 Sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS Predict reactive species Full Name: mitogen-activated protein kinase kinase 3 Calculated Molecular Weight: 347 aa, 39 kDa Observed Molecular Weight: 36-40 kDa GenBank Accession Number: BC032478 Gene Symbol: MAP2K3 Gene ID (NCBI): 5606 RRID: AB_3670384 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P46734 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924