Proteintech, 68576-1-Ig, CYP46A1 Monoclonal antibody

Size: 20ul / 150ul The CYP46A1 (68576-1-Ig) by Proteintech is a Monoclonal antibody targeting CYP46A1 in WB, IHC, ELISA applications with reactivity to Human, Mouse, Rat, Rabbit, Pig samples 68576-1-Ig targets CYP46A1 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat, Rabbit, Pig samples. Tested Applications Positive WB detected in: human brain tissue, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Cytochrome P450 46A1 (CYP46A1), also named as CYP46, P450 46A1, CH24H and Cholesterol 24-hydroxylase, belongs to the cytochrome P450 family. CYP46A1 is a central nervous system-specific enzyme, and can freely cross the blood-brain barrier and be degraded in the liver. It is involved in the turnover of cholesterol. It converts cholesterol into 24S-hydroxycholesterol and, to a lesser extent, 25-hydroxycholesterol. CYP46A1 is significantly upregulated in hepatic lymphomyeloid cells compared with ESCs.(PMID:20039312) Specification Tested Reactivity: Human, Mouse, Rat, Rabbit, Pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16786 Product name: Recombinant human CYP46A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 201-500 aa of BC022539 Sequence: TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC Predict reactive species Full Name: cytochrome P450, family 46, subfamily A, polypeptide 1 Calculated Molecular Weight: 500 aa, 57 kDa Observed Molecular Weight: 57 kDa GenBank Accession Number: BC022539 Gene Symbol: CYP46A1 Gene ID (NCBI): 10858 RRID: AB_3085276 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9Y6A2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.