Iright
BRAND / VENDOR: Proteintech

Proteintech, 68615-1-Ig, SPIN1 Monoclonal antibody

CATALOG NUMBER: 68615-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPIN1 (68615-1-Ig) by Proteintech is a Monoclonal antibody targeting SPIN1 in WB, ELISA applications with reactivity to Human, mouse, rat, rabbit samples 68615-1-Ig targets SPIN1 in WB, ELISA applications and shows reactivity with Human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: LNCaP cells, NCCIT cells, rabbit brain tissue, SK-BR-3 cells, HeLa cells, Jurkat cells, K-562 cells, rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SPIN1 (Spindlin 1) is a histone methylation reader, which recognizes trimethylated histone H3 lysine 4 through the protein-protein interaction. SPIN1 was initially found in ovarian cancer via searching ovarian cancer-related genes . It is overexpressed in ovarian cancer tissue, which exhibits a high homology to mouse Spin (Spindlin) gene. Signaling pathways responsible for SPIN1 functions include PI3K/Akt, Wnt and RET that are highly relevant to tumorigenesis.(PMID: 34492335, PMID: 31790762) Specification Tested Reactivity: Human, mouse, rat, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33686 Product name: Recombinant human SPIN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-262 aa of BC013571 Sequence: MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS Predict reactive species Full Name: spindlin 1 Calculated Molecular Weight: 262 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC013571 Gene Symbol: SPIN1 Gene ID (NCBI): 10927 RRID: AB_3085309 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y657 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924