Iright
BRAND / VENDOR: Proteintech

Proteintech, 68624-1-Ig, FAHD1 Monoclonal antibody

CATALOG NUMBER: 68624-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAHD1 (68624-1-Ig) by Proteintech is a Monoclonal antibody targeting FAHD1 in WB, ELISA applications with reactivity to Human, rat samples 68624-1-Ig targets FAHD1 in WB, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: rat kidney tissue, HepG2 cells, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Fumarylacetoacetate hydrolase domain containing protein 1 (FAHD1) is a eukaryotic member of the fumarylacetocetate hydrolase (FAH) superfamily of enzymes. It acts as an oxaloacetate decarboxylase (ODx), catalyzing the decarboxylation of oxaloacetate (OAA) to pyruvate and CO2. Specification Tested Reactivity: Human, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23956 Product name: Recombinant human FAHD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 28-226 aa of BC063017 Sequence: ADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPAYTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAKSFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLEEGDIILTGTPKGVGPVKENDEIEAGIHGLPKVSSATLPVRLQE Predict reactive species Full Name: fumarylacetoacetate hydrolase domain containing 1 Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC063017 Gene Symbol: FAHD1 Gene ID (NCBI): 81889 RRID: AB_3085316 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6P587 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924