Iright
BRAND / VENDOR: Proteintech

Proteintech, 68643-1-Ig, EGFR Monoclonal antibody

CATALOG NUMBER: 68643-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EGFR (68643-1-Ig) by Proteintech is a Monoclonal antibody targeting EGFR in WB, IF/ICC, FC, ELISA, Blocking applications with reactivity to human samples 68643-1-Ig targets EGFR in WB, IF/ICC, FC, ELISA, Blocking applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SCaBER cells, HaCaT cells, MDA-MB-468 cells, A431 cells Positive IF/ICC detected in: HaCaT cells, A431 cells Positive FC detected in: A431 cells Positive Blocking detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Flow Cytometry (FC): FC : 0.20 ug per 10^6 cells in a 100 µl suspension BLOCKING: BLOCKING : 1:10-1:100 Background Information EGFR, also named ERBB1, is a cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. Binding of the protein to a ligand induces receptor dimerization and tyrosine autophosphorylation and leads to cell proliferation. The gene resides on chromosome 7p12, encoding a 170 kDa membrane-associated glycoprotein. Recent studies have shown EGFR plays a critical role in cancer development and progression, including cell proliferation, apoptosis, angiogenesis, and metastatic spread. Mutations in this gene are associated with lung cancer. When stained with live cells, EGFR can be transported into the cell interior, which is consistent with the literature report (PMID: 18084617). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24947 Product name: Recombinant human EGFR protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 291-534 aa of BC094761 Sequence: VCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNC Predict reactive species Full Name: epidermal growth factor receptor (erythroblastic leukemia viral (v-erb-b) oncogene homolog, avian) Calculated Molecular Weight: 134kd Observed Molecular Weight: 160 kDa GenBank Accession Number: NM_005228.5 Gene Symbol: EGFR Gene ID (NCBI): 1956 RRID: AB_3670387 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P00533 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924