Iright
BRAND / VENDOR: Proteintech

Proteintech, 68647-1-Ig, SHCBP1 Monoclonal antibody

CATALOG NUMBER: 68647-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SHCBP1 (68647-1-Ig) by Proteintech is a Monoclonal antibody targeting SHCBP1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68647-1-Ig targets SHCBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, U2OS cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information SHCBP1 was initially identified as a potential gene associated with cell proliferation in fibroblasts. SHCBP1 exerts a crucial physiological function in normal tissue development. Chen et al. showed that SHCBP1 is an essential component of FGF signaling in neural progenitor cells. SHCBP1 is also upregulated during T cell proliferation and regulates CD4+ T cell effector function in vivo. Recently, SHCBP1 was shown to be closely associated with cancer development. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17517 Product name: Recombinant human SHCBP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 374-672 aa of BC030699 Sequence: NACFEGDTVIVCPGHYVVHGTFSIADSIELEGYGLPDDIVIEKRGKGDTFVDCTGADIKISGIKFVQHDAVEGILIVHRGKTTLENCVLQCETTGVTVRTSAEFLMKNSDLYGAKGAGIEIYPGSQCTLSDNGIHHCKEGILIKDFLDEHYDIPKISMVNNIIHNNEGYGVVLVKPTIFSDLQESAEDGTEENKALKIQTSGEPDVAERVDLEELIECATGKMELCARTDPSEQVEGNCEIVNELIAASTQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFLF Predict reactive species Full Name: SHC SH2-domain binding protein 1 Calculated Molecular Weight: 672 aa, 76 kDa Observed Molecular Weight: 76 kDa GenBank Accession Number: BC030699 Gene Symbol: SHCBP1 Gene ID (NCBI): 79801 RRID: AB_3670390 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8NEM2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924