Iright
BRAND / VENDOR: Proteintech

Proteintech, 68725-1-Ig, ADAM17 Monoclonal antibody

CATALOG NUMBER: 68725-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADAM17 (68725-1-Ig) by Proteintech is a Monoclonal antibody targeting ADAM17 in WB, ELISA applications with reactivity to Human, Mouse samples 68725-1-Ig targets ADAM17 in WB, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: U2OS cells, NIH/3T3 cells, Calu-3 cells, A549 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information The ADAMs (A Disintegrin And Metalloprotease) are multidomain transmembrane proteins. One of the first ADAMs implicated in membrane shedding is ADAM-17, which is shown to release the active form of tumor necrosis factor (TNF)-a from its precursor (PMID:18238782). ADAM17 is also named as CSVP, TACE. The full length protein has 9 glycosylation sites, a signal peptide, propeptide and 2 isoforms produced by alternative splicing.The 120-kDa form of ADAM-17 is expressed more frequently and at higher levels in primary breast carcinomas compared with normal breast tissue(PMID:17438092). Specification Tested Reactivity: Human, Mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag34022 Product name: Recombinant human ADAM17 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 693-824 aa of BC136783 Sequence: CVDKKLDKQYESLSLFHPSNVEMLSSMDSASVRIIKPFPAPQTPGRLQPAPVIPSAPAAPKLDHQRMDTIQEDPSTDSHMDEDGFEKDPFPNSSTAAKSFEDLTDHPVTRSEKAASFKLQRQNRVDSKETEC Predict reactive species Full Name: ADAM metallopeptidase domain 17 Calculated Molecular Weight: 824 aa, 93 kDa Observed Molecular Weight: 90-110 kDa GenBank Accession Number: BC136783 Gene Symbol: ADAM17 Gene ID (NCBI): 6868 RRID: AB_3670417 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P78536 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924