Proteintech, 68889-1-Ig, NOP2 Monoclonal antibody

Size: 20ul / 150ul The NOP2 (68889-1-Ig) by Proteintech is a Monoclonal antibody targeting NOP2 in WB, IF/ICC, ELISA applications with reactivity to human samples 68889-1-Ig targets NOP2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, Daudi cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:280-1:1122 Background Information NOL1, (synonyms: p120, NSUN1, NOP120), is a 120 kDa proliferating-cell nucleolar antigen and is the most cancer specific of the proliferation-associated nucleolar proteins identified thus far. NOL1 is expressed in G1 and peaks during the early S phase of the cell cycle and it has not been detected in benign tumors and most normal resting tissues. Overexpression of NOL1 caused the transformation of NIH 3T3 cells and expression of an antisense NOL1 construct inhibited the growth of NIH 3T3 cells. NOL is localized in a novel nucleolar microfibrillar structure, and contains, consecutively, four major domains: a basic domain, an acidic domain, a hydrophobic and methionine-rich domain, and a domain rich in cysteine and proline residues. The gene for human NOL1 was assigned to chromosome 12p13 (PMID: 23775790). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag33985 Product name: Recombinant human NOP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-170 aa of BC000656 Sequence: GRKLDPTKEKRGPGRKARKQKGAETELVRFLPAVSDENSKRLSSRARKRAAKRRLGSVEAPKTNKSPEAKPLPGKLPKGISAGAVQTAGKKGPQSLFNAPRGKKRPAPGSDEEEEEEDSEEDGMVNHGDLWGSEDDADTVDDYGADSNSEDEEEGEALLPIERAARKQK Predict reactive species Full Name: NOP2 nucleolar protein homolog (yeast) Calculated Molecular Weight: 120 kDa Observed Molecular Weight: 100-120 kDa GenBank Accession Number: BC000656 Gene Symbol: NOP2 Gene ID (NCBI): 4839 RRID: AB_3670447 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P46087 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.