Iright
BRAND / VENDOR: Proteintech

Proteintech, 68923-1-Ig, THEM4 Monoclonal antibody

CATALOG NUMBER: 68923-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The THEM4 (68923-1-Ig) by Proteintech is a Monoclonal antibody targeting THEM4 in WB, ELISA applications with reactivity to human samples 68923-1-Ig targets THEM4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A375 cells, HepG2 cells, HeLa cells, DU 145 cells, LNCaP cells, HEK-293 cells, K-562 cells, TF-1 cells, HL-60 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information THEM4, which stands for thioesterase superfamily member 4, is a gene in humans that encodes a protein involved in the regulation of the protein kinase B (PKB), also known as Akt pathway. This gene is ubiquitously expressed in various tissues, with notable expression in the kidney and testis. THEM4 can also promote the proliferation of tumor cells by positively regulating Akt activity in breast cancer and nasopharyngeal carcinoma, which presents a contrasting role to its initial characterization. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6296 Product name: Recombinant human THEM4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-240 aa of BC065277 Sequence: MLRSCAARLRTLGALCRPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLMKEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT Predict reactive species Full Name: thioesterase superfamily member 4 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC065277 Gene Symbol: CTMP Gene ID (NCBI): 117145 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5T1C6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924