Iright
BRAND / VENDOR: Proteintech

Proteintech, 80501-1-RR, TOM20 Recombinant monoclonal antibody

CATALOG NUMBER: 80501-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The TOM20 (80501-1-RR) by Proteintech is a Recombinant antibody targeting TOM20 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, chicken, zebrafish samples 80501-1-RR targets TOM20 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, chicken, zebrafish samples. Tested Applications Positive WB detected in: HeLa cells, zebrafish tissue, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, pig brain tissue, rat brain tissue, mouse brain tissue, chicken brain tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:120-1:480 Background Information TOM20, also named as KIAA0016, belongs to the Tom20 family. It is a central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22, TOM20 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore. TOM20 is characterized as major docking receptors to mediate the recognition by different mechanisms. Specification Tested Reactivity: human, mouse, rat, pig, chicken, zebrafish Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag2378 Product name: Recombinant human TOM20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-145 aa of BC000882 Sequence: MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE Predict reactive species Full Name: translocase of outer mitochondrial membrane 20 homolog (yeast) Calculated Molecular Weight: 145 aa, 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC000882 Gene Symbol: TOM20 Gene ID (NCBI): 9804 RRID: AB_2918897 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q15388 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924