Proteintech, 80543-1-RR, Connexin 43 Recombinant monoclonal antibody

Size: 20ul / 100ul The Connexin 43 (80543-1-RR) by Proteintech is a Recombinant antibody targeting Connexin 43 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 80543-1-RR targets Connexin 43 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, pig brain tissue, rat cerebellum tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Connexin 43 (Cx43, also known as gap junction alpha-1), a member of connexin family, plays essential roles in gap junction communication that facilitates direct communication among adjacent cells (PMID: 12270943). Usually, six connexin proteins oligomerize into a hemi-channel or connexon during intercellular channel formation (PMID: 12270943). Mutations of Connexin 43 may cause a series of diseases such as oculodentodigital dysplasia (ODDD), syndactyly 3 (SDTY3), hypoplastic left heart syndrome 1 (HLHS1) and so on (PMID: 18161618, 1472936, 1147490). Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25533 Product name: Recombinant human Connexin 43 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 232-382 aa of BC026329 Sequence: FFKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI Predict reactive species Full Name: gap junction protein, alpha 1, 43kDa Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC026329 Gene Symbol: Connexin-43 Gene ID (NCBI): 2697 RRID: AB_2935545 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P17302 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.