Proteintech, 80613-2-RR, LATS1 Recombinant monoclonal antibody

Size: 20ul / 100ul The LATS1 (80613-2-RR) by Proteintech is a Recombinant antibody targeting LATS1 in WB, ELISA applications with reactivity to human, mouse, rat samples 80613-2-RR targets LATS1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, HepG2 cells, HT-29 cells, A549 cells, NIH/3T3 cells, C2C12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information LATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongs to the AGC Ser/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11140 Product name: Recombinant human LATS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-135 aa of BC015665 Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI Predict reactive species Full Name: LATS, large tumor suppressor, homolog 1 (Drosophila) Calculated Molecular Weight: 15 kDa, 127 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC015665 Gene Symbol: LATS1 Gene ID (NCBI): 9113 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6PJG3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.