Iright
BRAND / VENDOR: Proteintech

Proteintech, 80721-1-RR, SYNPO Recombinant monoclonal antibody

CATALOG NUMBER: 80721-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The SYNPO (80721-1-RR) by Proteintech is a Recombinant antibody targeting SYNPO in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 80721-1-RR targets SYNPO in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue, pig brain tissue Positive IHC detected in: human kidney tissue, mouse brain tissue, mouse kidney tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:17800 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Synaptopodin is a actin-associated protein expressed in mature dendritic spines and renal podocytes. Several isoforms of synaptopodin have been reported: the 100 kDa neural form and 110 kDa renal form. 44-45 kDa may represent the degradation product of synaptopodin. As a podocyte specific protein, synaptopodin expression level was decreased in kidney but increased in the urinary podocytes from patients with preeclampsia, indicating that synaptopodin is a useful marker for preeclampsia. (15841212, 10555072) Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag31287 Product name: Recombinant human SYNPO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 336-510 aa of BC146665 Sequence: SPPSYSVLYPSSDPKSSHLKGQAVPASKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRRQRDQGEVGVEEEPFALGAEASNFQQEPAPRDRASPAAAEEVVPEWASCLKSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSSHTPELARCPS Predict reactive species Full Name: synaptopodin Calculated Molecular Weight: 929 aa, 99 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC146665 Gene Symbol: SYNPO Gene ID (NCBI): 11346 RRID: AB_2918907 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8N3V7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924