Iright
BRAND / VENDOR: Proteintech

Proteintech, 80756-1-RR, PAX8 Recombinant monoclonal antibody

CATALOG NUMBER: 80756-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The PAX8 (80756-1-RR) by Proteintech is a Recombinant antibody targeting PAX8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 80756-1-RR targets PAX8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells, rat kidney tissue Positive IHC detected in: human ovary tumor tissue, human ovary cancer tissue, human renal cell carcinoma tissue, human thyroid cancer tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SKOV-3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Immunofluorescence (IF)/ICC: IF/ICC : 1:650-1:2600 Background Information PAX8 is a member of the paired box (PAX) family of transcription factors, typically containing a paired box domain and a paired-type homeodomain. It is expressed during organogenesis of the thyroid gland, kidney and Mullerian system. It is thought to regulate the expression of Wilms tumor suppressor (WT1) gene and mutations in PAX8 have been associated with Wilms tumor cells, thyroid and ovarian carcinomas. PAX8 is a useful marker in distinguishing ovarian carcinomas from mammary carcinomas (PMID: 18724243). PAX8 is expressed in a high percentage of ovarian serous, endometrioid, and clear cell carcinomas, but only rarely in primary ovarian mucinous adenocarcinoma. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0306 Product name: Recombinant human PAX8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC001060 Sequence: MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDS Predict reactive species Full Name: paired box 8 Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 48 kDa, 58 kDa GenBank Accession Number: BC001060 Gene Symbol: PAX8 Gene ID (NCBI): 7849 RRID: AB_2923693 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q06710 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924