Iright
BRAND / VENDOR: Proteintech

Proteintech, 80777-1-RR, G3BP1 Recombinant monoclonal antibody

CATALOG NUMBER: 80777-1-RR
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 100ul The G3BP1 (80777-1-RR) by Proteintech is a Recombinant antibody targeting G3BP1 in IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 80777-1-RR targets G3BP1 in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: sodium arsenite treated HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information GAP SH3 Binding Protein 1 (G3BP1), also named as G3BP, is an effector of stress granule (SG) assembly. SG biology plays an important role in the pathophysiology of TDP-43 in ALS and FTLD-U. G3BP1 can be used as a marker of SG. It has been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation. G3BP1 is a ubiquitously expressed protein that localizes to the cytoplasm in proliferating cells and to the nucleus in non-proliferating cells. G3BP1 has recently been implicated in cancer biology. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3728 Product name: Recombinant human G3BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 167-466 aa of BC006997 Sequence: PDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ Predict reactive species Full Name: GTPase activating protein (SH3 domain) binding protein 1 Calculated Molecular Weight: 466 aa, 52 kDa GenBank Accession Number: BC006997 Gene Symbol: G3BP1 Gene ID (NCBI): 10146 RRID: AB_3086456 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13283 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924