Proteintech, 80821-3-RR, p38 MAPK Recombinant monoclonal antibody

Size: 20ul / 100ul The p38 MAPK (80821-3-RR) by Proteintech is a Recombinant antibody targeting p38 MAPK in WB, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 80821-3-RR targets p38 MAPK in WB, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HepG2 cells, mouse brain tissue, HeLa cells, HEK-293 cells, A549 cells, PC-12 cells, RAW.264.7 cells Positive IP detected in: HEK-293 cells Positive FC (Intra) detected in: HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information MAPK14(mitogen-activated protein kinase 14) is also named as SAPK2A, p38MAPK, CSBP1, RK, p38, EXIP, Mxi2, CSBP2, PRKM14, PRKM15, CSPB1, p38ALPHA and belongs to the MAP kinase subfamily. MAPK14-signaling is a central pathway for the integration of instructive signals in dendritic cells for T(H)17 differentiation and inflammation(PMID:22231518). It plays an important role in the regulation of hematopoietic stem cell self-renewal in vitro and inhibition of MAPK14 activation with a small molecule inhibitor may represent a novel approach to promote ex vivo expansion of hematopoietic stem cell(PMID:21198398). This protein has 4 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5115 Product name: Recombinant human p38 MAPK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-307 aa of BC031574 Sequence: MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAY Predict reactive species Full Name: mitogen-activated protein kinase 14 Calculated Molecular Weight: 360 aa, 41 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC031574 Gene Symbol: p38 MAPK Gene ID (NCBI): 1432 RRID: AB_3670490 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16539 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.