Proteintech, 80932-1-RR, DDX21 Recombinant monoclonal antibody

Size: 20ul / 100ul The DDX21 (80932-1-RR) by Proteintech is a Recombinant antibody targeting DDX21 in WB, IF/ICC, ELISA applications with reactivity to human samples 80932-1-RR targets DDX21 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, THP-1 cells, Jurkat cells, K-562 cells, HL-60 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information DDX21 protein belongs to DEAD box protein family which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). As a putative RNA helicase, DDX21 unwinds double-stranded RNA, folds single-stranded RNA and is involved in process including ribosomal RNA biogeneis, RNA editing and general transcription. Interaction of DDX21 and c-Jun was reported in ribosomal RNA processing. DDX21 exists as two isoforms, molecular weight of modified isoform one is about 87 -100 kDa, and the post-modified isoform is about 75-85 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0804 Product name: Recombinant human DDX21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC008071 Sequence: MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIP Predict reactive species Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 Calculated Molecular Weight: 87 kDa Observed Molecular Weight: 87 kDa GenBank Accession Number: BC008071 Gene Symbol: DDX21 Gene ID (NCBI): 9188 RRID: AB_2918920 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NR30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.