Proteintech, 81115-1-RR, Beta Actin Recombinant monoclonal antibody

Size: 100ul The Beta Actin (81115-1-RR) by Proteintech is a Recombinant antibody targeting Beta Actin in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig samples 81115-1-RR targets Beta Actin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, rat brain tissue, mouse brain tissue, pig brain tissue Positive IP detected in: HeLa cells Positive IHC detected in: rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, MDCK cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:950-1:3800 Background Information Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40, 31, 15 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody was generated against N-terminal region of human beta actin protein and can cross-react with other actins. (9173887, 11217076, 10229193 ) Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig, monkey, chicken, bovine, goat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14521 Product name: Recombinant human beta actin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC002409 Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK Predict reactive species Full Name: actin, beta Calculated Molecular Weight: 375 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC002409 Gene Symbol: Beta Actin Gene ID (NCBI): 60 RRID: AB_2923704 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P60709 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.